Dear users
I am beginner of modeller when i do basic homology modeling i got error as follows read_te_291E> Sequence difference between alignment and pdb : x (mismatch at alignment position 1) Alignment MNQVQRSNELSQERTARLNELQRALVMMDSDFRQIALRQTRTNGEEPSKKLLHWA PDB TVGYLEQKMFAAMVADNQMAMVMLNPKNLKASNGEEELAGQTWYWKVAPVATTQP Match * Alignment residue type 11 (M, MET) does not match pdb residue type 17 (T, THR), for align code 2ret (atom file 2ret), pdb residue number "30", chain "A"
Please check your alignment file header to be sure you correctly specified the starting and ending residue numbers and chains. The alignment sequence must match that from the atom file exactly. Even i searched the mailing list i got information but i am not able to understand error . Please is very useful if you point out where i have committed the mistake Thanks in advance
with high regardsS.vidhyasnakr