On Tue, 10 Feb 2004 09:15:53 +0100 Esben Jannik Bjerrum esbenjannik@rocketmail.com wrote: > I'm currently blocked by an unusual problem. Running modeller > for sequence search, it ends with a Divide__213E> Division by zero,
> My NR2BS1S2.ali > >P1;NR2BS1S2 > sequence:NR2BS1S2:::::::0.00: 0.00 > qeddhlsiVtleeapfvivesvdplsgtcmrntvpcqkrivtenktdeepgyikkcckgf > cidilkkisksvkftydlylvtngkhgkkingtwngmigevvmkraymavgsltineers > evvdfsvpfietgisvmvskgtqvsglsdkkfqrpndfsppfrfgtvpngsternirnny > aemhaymgkfnqrgvddallslktgkldafiydaavlnymagrdegcklvtigsgkvfas > tgygiaiqkdsgwkrqvdlailqlfgdgemeelealwltgichne*
For superstitious reasons, perhaps, I usually use capital letters for the amino-acids, and put the residue numbers in the 'sequence:NR2PBS1S2:.' line.
Your error looks like it is due to an alignment that is too small, since it appears that only the 'V' is aligned, despite the obvious homology between both sequences.
j.
_______________________________________________________________________ Dr JB Procter:Biomolecular Modelling at ZBH - Center for Bioinformatics Hamburg http://www.zbh.uni-hamburg.de/staff.php