Alignment        VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQ

       PDB        IQKVQDDTKTLIKTIVTRINDILDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRN

     Match                 *                                     ***

  Alignment residue type   18 (V, VAL) does not match pdb

  residue type    8 (I, ILE),

  for align code 1AX8 (atom file 1AX8), pdb residue number "3", chain "A"

  Please check your alignment file header to be sure you correctly specified

  the starting and ending residue numbers and chains. The alignment sequence

  must match that from the atom file exactly.

  Another possibility is that some residues in the atom file are missing,

  perhaps because they could not be resolved experimentally. (Note that Modeller

  reads only the ATOM and HETATM records in PDB, NOT the SEQRES records.)

  In this case, simply replace the section of your alignment corresponding

  to these missing residues with gaps.

read_te_288W> Protein not accepted:        1  1AX8

Cn u pls help regarding this ..

Bharat