Dear Modellers, I tried to search my sequence aganist the Modeller chain database. But my top file containing the search commands did not yield me any result after long time run. Here I pasted my topfile,alignment Top File SET SEARCH_RANDOMIZATIONS = 10 SET FILE = 'gam.ali' SEQUENCE_SEARCH ALIGN_CODES = 'gam' alignment file:

>P1;gam sequence:gam:1 : :136 : : LNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYVDNVD RFPDHDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMLVGDVSCI PFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA*

The logfile did not contain any messages other than usual Heading that appear in all logfiles.

Kindly help me.

Yours, B.Nataraj

--------------------------------- Yahoo! Messenger - Communicate instantly..."Ping" your friends today! Download Messenger Now