Next: Changing the default optimization Up: More advanced usage Previous: More advanced usage Contents Index
If your template contains a ligand or other non-protein residues (e.g. DNA or RNA, or anything marked as HETATM in the PDB file) then MODELLER can transfer this into your generated model. This is done by using the BLK ('.') residue type in your alignment (both in the template(s) and the model sequence) to copy the ligand residue(s) as a rigid body into the model. In most cases, you should also set env.io.hetatm to True, which instructs MODELLER to read HETATM records from your template PDB files; by default all HETATM records are ignored.
# Comparative modeling with ligand transfer from the template from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the AutoModel class log.verbose() # request verbose output env = Environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.', '../atom_files'] # Read in HETATM records from template PDBs env.io.hetatm = True a = AutoModel(env, alnfile = 'align-ligand.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 4 # index of the first model a.ending_model = 4 # index of the last model # (determines how many models to calculate) a.make() # do the actual comparative modeling
C; Similar to alignment.ali, but with ligands included >P1;5fd1 structureX:5fd1:1 :A:108 :A:ferredoxin:Azotobacter vinelandii: 1.90: 0.19 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELA EVWPNITEKKDPLPDAEDWDGVKGKLQHLER..* >P1;1fdx sequence:1fdx:1 :A:56 :A:ferredoxin:Peptococcus aerogenes: 2.00:-1.00 AYVINDSC--IACGACKPECPVNIIQGS--IYAIDADSCIDCGSCASVCPVGAPNPED----------------- -------------------------------..*
Note that by turning on env.io.hetatm, all HETATM records are read from your templates, so all of these must be listed in your alignment. Use a single '.' character for each HETATM residue in the template sequence in your alignment.2.1 MODELLER always reads PDB residues in the order they're written in the PDB file, so if you have a ligand at the end of PDB file, put the '.' residue at the end of the sequence in the alignment too. You will also need to modify the residue range in the alignment header to tell MODELLER to read the ligands from the PDB file - in this case the range is changed from 106:A (in Section 2.1) to 108:A, as the two residues are numbered 107 and 108 in the A chain. You will often see a chain break ('/') immediately preceding '.' residues in example alignments. That's only necessary if you want to force the ligands to have a different chain ID to the amino acids. (If you want them in the same chain, leave out the chain break.)
To get the ligand into your model, you must align a residue in the model with the desired residue in the template. Use a single '.' residue in your model sequence in your alignment for each ligand you want in the model. This must be aligned with a suitable ligand in the template sequence. If you have extra HETATM ligands in the template which you don't want in the model, simply align them with a gap ('-') in the model sequence. If you have multiple templates, you can copy ligands from any suitable template — just align the '.' residue in the model with the desired template sequence ligand.
AutoModel builds restraints on these ligands to keep their geometry and environment reasonably similar to the template, by restraining some intra-ligand, inter-ligand, and ligand-protein distances to their template values. See AutoModel.nonstd_restraints() for more information.
You can also treat ligands flexibly by defining topology and parameter information. See section 5.2.1 for more information, and the example in the advanced modeling tutorial, at https://salilab.org/modeller/tutorial/advanced.html.
If you want to add ligands to your model which are not present in your template, you will need to do some docking studies, which are beyond the scope of the MODELLER program.
To read in water residues, set env.io.water to True and use the 'w' residue type in your alignment.
To read in hydrogen atoms, set env.io.hydrogen to True. This is not generally necessary, as if you want to build an all hydrogen model, it is easiest just to use the AllHModel class, which turns this on for you automatically; see section 2.2.5.