PDB

PDB Files, Sequences and Clusters

/netapp/database/pdb/chains/bl/3blm> more 3blm.chn
C; Produced by MODELLER

>P1;3blm
structureX:3blm:  31 : : 290 : :BETA-*LACTAMASE (E.C.3.5.2.6):(STAPHYLOCOCCUS $AUREUS /PC1$): 2.00:-1.00
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPI
LEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTP
AAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEP
IVLVIFTNKDNKSDKPNDKLISETAKSVMKEF*

PDB Profiles

[/netapp/home/eashwar/PDB95/db]> more pdb95_prf.list 
/netapp/home/eashwar/PDB95/data/sw/1swyA/1swyA-uniprot90.prf
/netapp/home/eashwar/PDB95/data/a6/1a6m/1a6m-uniprot90.prf
/netapp/home/eashwar/PDB95/data/nw/2nwdX/2nwdX-uniprot90.prf
/netapp/home/eashwar/PDB95/data/a2/2a2rA/2a2rA-uniprot90.prf

Sequence Databases

NR

formatdb.log
nr
nr_indexed.phr
nr_indexed.pin
nr_indexed.pnd
nr_indexed.pni
nr_indexed.psd
nr_indexed.psi
nr_indexed.psq
nr.phr
nr.pin
nr.psq
nr.ready
pdbaa
pdbaa.phr
pdbaa.pin
pdbaa.psq

NT

nt
nt.00.nhr
nt.00.nin
nt.00.nsq
nt.01.nhr
nt.01.nin
nt.01.nsq
nt.nal
nt_indexed.00.nhr
nt_indexed.00.nin
nt_indexed.00.nnd
nt_indexed.00.nni
nt_indexed.00.nsd
nt_indexed.00.nsi
nt_indexed.00.nsq
nt_indexed.01.nhr
nt_indexed.01.nin
nt_indexed.01.nnd
nt_indexed.01.nni
nt_indexed.01.nsd
nt_indexed.01.nsi
nt_indexed.01.nsq
nt_indexed.nal

Uniprot

uniprot
uniprot.hdf5
uniprot.phr
uniprot.pin
uniprot.psq
uniprot.ready

uniprot90.hdf5
uniprot90.phr
uniprot90.pin
uniprot90.psq
uniprot90.ready
uniprot90

Other Databases

SCOP

Requests for other Databases

QB3cluster: Biological_Databases (last edited 2016-07-13 23:04:29 by Joshua_Baker-LePain)