Dear All,
I am a new user to modeller am having a few teething problems. I am trying
to align a sequence against an NMR structure of a related protein but am
getting an error of
rdpir___648E> Alignment sequence not found in PDB file: 1 ./dva.atm
recover____E> ERROR_STATUS >= STOP_ON_ERROR: 1 1
The script file is attached below (and I do have a file ./dva.atm) The
sequences in alignment and atm files also match exactly.
>From the manual I was unclear how the options structureX and structureN and
so wonder whether there are strict formatting requirements for the pdb entry
(some of the pdb is also attached below). I edited the NMR model down to
one solution as I couldn't find any info on how modeller deals with NMR
models. As a related question if anybody could shed some light on how NMR
models are dealt with differently (if at all) compared to say
crystallographic models and if multiple NMR models of the same structure can
be used as models without inputting each as a separate structure I would be
very interested to hear,
Thanks in Advance for your help
Simon Holton,
More ./aln.ali
>P1;dva
structureX:dva:::::::
QEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE*
>P1;uba
sequence:uba:::::::
ERYEHQLRQLNDMGFFDFDRNVAAKRRSGGSVQALDSLLNGDV--*
More ./dva.atm
ATOM 1 N GLN A 1 28.264 11.297 6.524 1.00 0.00
ATOM 2 CA GLN A 1 29.549 11.974 6.654 1.00 0.00
ATOM 3 C GLN A 1 30.660 11.272 5.855 1.00 0.00
ATOM 4 O GLN A 1 31.702 11.865 5.591 1.00 0.00
ATOM 5 CB GLN A 1 29.969 12.114 8.135 1.00 0.00
ATOM 6 CG GLN A 1 29.478 13.426 8.785 1.00 0.00
ATOM 7 CD GLN A 1 30.626 14.303 9.317 1.00 0.00
ATOM 8 OE1 GLN A 1 30.822 15.438 8.887 1.00 0.00
ATOM 9 NE2 GLN A 1 31.337 13.724 10.301 1.00 0.00
ATOM 10 H GLN A 1 28.069 11.159 5.506 1.00 0.00
ATOM 11 HA GLN A 1 29.432 12.960 6.205 1.00 0.00
ATOM 12 1HB GLN A 1 29.572 11.270 8.700 1.00 0.00
ATOM 13 2HB GLN A 1 31.051 12.022 8.242 1.00 0.00
ATOM 14 1HG GLN A 1 28.910 14.034 8.087 1.00 0.00
ATOM 15 2HG GLN A 1 28.785 13.199 9.596 1.00 0.00
ATOM 16 1HE2 GLN A 1 31.194 12.757 10.532 1.00 0.00
ATOM 17 2HE2 GLN A 1 32.016 14.236 10.824 1.00 0.00
More ./model_default.top
# Homology modelling by the MODELLER TOP routine 'model'.
INCLUDE # Include the predefined TOP routines
SET OUTPUT_CONTROL = 1 1 1 1 1 # uncomment to produce a large log file
SET ALNFILE = 'aln.ali' # alignment filename
SET KNOWNS = 'dva' # codes of the templates
SET SEQUENCE = 'uba' # code of the target
SET ATOM_FILES_DIRECTORY = './'
SET STARTING_MODEL= 1 # index of the first model
SET ENDING_MODEL = 2 # index of the last model
# (determines how many models to
calculate)
CALL ROUTINE = 'model' # do homology modelling
**************************************************************
Dr. Simon Holton
Laboratory of Molecular Biophysics,
Rex Richards Building,
Department of Biochemistry,
University of Oxford
South Parks Road
Oxford
Tel: 01865 275379
Fax: 01865 275182
**************************************************************