[Date Prev][Date Next][Thread Prev][Thread Next][Date Index][Thread Index]

[modeller_usage] POSITION IONS IN MODELS



Greetings Forum users
I have a problem with adding Calcium ions in my models.
I'm using this TOP script:

#Homology modelling by the MODELLER TOP routine 'model'.

INCLUDE                             # Include the predefined TOP routines

SET OUTPUT_CONTROL = 1 1 1 1 1      # uncomment to produce a large log file
SET ALNFILE  = '23urom-1lmj.ali'   # alignment filename
SET KNOWNS   = '1lmjA'              # codes of the templates
SET SEQUENCE = '23urom'               # code of the target
SET ATOM_FILES_DIRECTORY = '/net/rossini/mesana/PROVA_MODELLER/MODELING_CALCIUM/1lmj.atm' # directories for input atom files
SET HETATM_IO = ON
SET STARTING_MODEL= 1               # index of the first model
SET ENDING_MODEL  = 10               # index of the last model
                                    # (determines how many models to calculate)

CALL ROUTINE = 'model'              # do homology modelling

And this is my alignment:
>P1;1lmjA
structureX:1lmj.pdb:   3 :A:+88  :A:undefined:undefined:-1.00:-1.00
TDIDECRISP--DLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECP
PGHQLSPNISACI33*

>P1;23urom
sequence:phd2:     : :     : ::: 0.00: 0.00
-DLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCP
AGYRGD--GWHCE33*

The models generated by MODELLER contain the ions:
ATOM    603  OXT GLU    85      14.608 -30.221 -12.881  1.00 30.85       1SG 604
TER     603      GLU    85                                               1SG 605
HETATM  604  CAL CAL    86      22.805 -57.972 -18.845  1.00  0.00       1SG 606
HETATM  605  CAL CAL    87     -43.926-115.000-182.203  1.00  0.00       1SG 607
END

But the position of these Calcium ions is completely wrong, outside of the molecule and differing from the template.
How can I solve this problem?
Many thanks in advance for your help,