Dear users

I am beginner of modeller when i do basic homology modeling i got error as follows  read_te_291E> Sequence difference between alignment and  pdb :                   x  (mismatch at alignment position      1)  Alignment        MNQVQRSNELSQERTARLNELQRALVMMDSDFRQIALRQTRTNGEEPSKKLLHWA        PDB        TVGYLEQKMFAAMVADNQMAMVMLNPKNLKASNGEEELAGQTWYWKVAPVATTQP      Match                                                 *   Alignment residue type   11 (M, MET) does not match pdb   residue type   17 (T, THR),   for align code 2ret (atom file 2ret), pdb residue number "30", chain "A"

Please check your alignment file header to be sure you correctly specified   the starting and ending residue numbers and chains. The alignment sequence   must match that from the atom file exactly. Even i searched the mailing list i got  information but i am not able to understand error . Please is very useful if you point out where i have  committed the mistake Thanks in advance

with high regardsS.vidhyasnakr