[Date Prev][Date Next][Thread Prev][Thread Next][Date Index][Thread Index]
[modeller_usage] Errors during generate alignment file for two chains
- To: <modeller_usage@listsrv.ucsf.edu>
- Subject: [modeller_usage] Errors during generate alignment file for two chains
- From: jitrayut jitonnom <jitrayut_018 AT hotmail.com>
- Date: Fri, 9 Mar 2007 16:37:42 +0700
Dear modeller users,
I have a question on how to generate an alignment of scFv antibody (two chains; light chain and heavy chain). My script is shown below
env = environ()
aln = alignment(env)
mdl = model(env, file='1P4I', model_segment=('FIRST:L','LAST:H'))
aln.append_model(mdl, align_codes='1P4I', atom_files='1P4I.pdb')
aln.append(file='scfv.ali', align_codes='scfv')
aln.align2d()
aln.write(file='scfv-1P4I.ali', alignment_format='PIR')
and the PIR file of scfv is
>P1;scfv
sequence:scfv:1:L:123:H:::0.00: 0.00
vmtqtpalmaaspgekvtitcsvsssisssnlhwyqqksetspkpwiygtsnlasgvpvrfsgsgsgtsysltis
smeaedaatyycqqwsnypltfgagtklelkssggggsggggggssrssl/evkllesggglvkpggslklscaas
gftfssyamswvrqtpekrlewvatissggtytyypdsvkgrftisrdnakntlylqmsslrsedtamyycarfr
ngaywgqgtlvtvsaatttapsv*
After i run the script above i found some errros like this;
read_al_373E> Protein specified in ALIGN_CODES(i) was not found
in the alignment file; ALIGN_CODES( 2) = scfv
So, if anyone can help me for this problem i will be appreciated.
Jitrayut
Discover the new Windows Vista Learn more!