[Date Prev][Date Next][Thread Prev][Thread Next][Date Index][Thread Index]
Re: [modeller_usage] How to incorporate NAD and water in my model
- To: "Charlie Allerston" <charlieboyblue AT hotmail.com>
- Subject: Re: [modeller_usage] How to incorporate NAD and water in my model
- From: "Schmid, Dr R." <rs206 AT leicester.ac.uk>
- Date: Thu, 15 Mar 2007 17:19:33 -0000
- Cc: modeller_usage@listsrv.ucsf.edu
Hi Charlie,
In the alignment file have you tried sth like the construct below?
>P1;template
<SNIP>
YIK/.*
>P1;target
<SNIP>
HIK/.*
Make sure your residue selection includes your NAD
ie
structureX:template:1:A:4:A:.:.:.:.
for the example given would correspond to the pdb file template.pdb with
TYR 1 A, ... FAD 4 A
Cheers,
Ralf
============================================
Dr Ralf Schmid
Lecturer in Bioinformatics
Department of Biochemistry
Henry Wellcome Building
University of Leicester
Lancaster Road
Leicester LE1 9HN UK
Tel. +44 (0)116 229 7023
============================================
> -----Original Message-----
> From: modeller_usage-bounces AT salilab.org
> [mailto:modeller_usage-bounces AT salilab.org] On Behalf Of
> Charlie Allerston
> Sent: 15 March 2007 16:22
> To: modeller-care@ucsf.edu
> Cc: modeller_usage@listsrv.ucsf.edu
> Subject: Re: [modeller_usage] How to incorporate NAD and
> water in my model
>
>
> >Charlie Allerston wrote:
> >>Do you have to use the modeller alignment script? I have
> been using
> >>ebi software to create a .pir file.
> >
> >No, you do not need to use Modeller to make your alignment file.
> >However, since there are no standard one-letter codes for
> ligands, you
> >will likely have to edit your original alignment in a text editor to
> >put in the ligands.
> >
>
> This is what I am not getting. Where to put the ligand in
> the alignment, regardless of what character to use.
> Take this for instance. trying to model something from the
> template 1VDC http://www.rcsb.org/pdb/explore.do?structureId=1VDC
> Looking at the PDB file it has 316 residues then it had a
> molecule of FAD tacked on at a position designated 400.
> So when I align this to some target like below (cropped).
>
>
> --------------------------MNGLETHNTRLCIVGSGPAAHTAAIYAARAELKP
> LLFEGWMANDIAPGGQLTTTTDVENFPGFPEGILGVELTDKFRKQSERFGTTIFTETVTK
> VDFSSKPFKLFTDS---KAILADAVILAIGAVAKRLSFVGSGEVLGGFWNRGISACAVCD
> GAAPIFRNKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDAFRASKIMQQRALSNPKID
> VIWNSSVVEAYGDGERDVLGGLKVKNVVTGDVSDLKVSGLFFAIGHEPATKFLDGGVELD
> SDGYVVTKPGTTQTSVPGVFAAGDVQDKKYRQAITAAGTGCMAALDAEHYLQEIGSQEGK
> SD-
> *
> >P1;fake1
>
> DASGLSVAAAATLSQKSTPYYQSEIHTIGKRRMHSKVVIIGSGPAAHTAAIYLARAELKP
> VLYEGFMANGVAAGGQLTTTTEVENFPGFPEAVTGQELMDKMRAQSERFGTVIVSETVGK
> LDLSKRPFEYSTEWSPDTVMTADAVILATGASARRLGLPGED----KYWQNGISACAVCD
> GAVPIFRNKPLVVIGGGDSAAEEAIFLTKYGSHVTVLVRRDKLRASSIMARRLLAN----
> ------------------------------------------------------------
> -------------KKVTGLFAAGDVQDKRYRQAITSAGTGCMAALDAEKYLEELEDEQAD
> GKL
> *
>
> Where should I stick the fad? At the end? How many blk
> characters should I tack on? 1 because there is only one
> molecule? Is there a specific character for FAD?
>
> These are my stumbling blocks.
>
> regards
>
> _________________________________________________________________
> Solve the Conspiracy and win fantastic prizes.
> http://www.theconspiracygame.co.uk/
>
> _______________________________________________
> modeller_usage mailing list
> modeller_usage@listsrv.ucsf.edu
> https://salilab.org/mailman/listinfo/modeller_usage
>