[Date Prev][Date Next][Thread Prev][Thread Next][Date Index][Thread Index]

[modeller_usage] run two file or two restrained together



Hello, 
I try to modeller my protein, and I had two different files which succerful good independely, but I need to uses the restrained from the firts file in combination of the symetry restrained of the second file.
Down, I just copied the type file I have used. How can I run both at the same time?
thank you !!
 
 
# Addition of restraints to the default ones
from modeller import *
from modeller.automodel import *    # Load the automodel class

log.verbose()
env = environ()

# directories for input atom files
env.io.atom_files_directory = ['.', '../atom_files']

class MyModel(automodel):
    def special_restraints(self, aln):
        rsr = self.restraints
        at = self.atoms
#       Add some restraints from a file:
#       rsr.append(file='my_rsrs1.rsr')

#       Residues 20 through 30 should be an alpha helix:
        rsr.add(secondary_structure.alpha(self.residue_range('20:', '30:')))
#       Two beta-strands:
        rsr.add(secondary_structure.strand(self.residue_range('1:', '6:')))
        rsr.add(secondary_structure.strand(self.residue_range('9:', '14:')))
#       An anti-parallel sheet composed of the two strands:
        rsr.add(secondary_structure.sheet(at['N:1'], at['O:14'],
                                          sheet_h_bonds=-5))
#       Use the following instead for a *parallel* sheet:
#       rsr.add(secondary_structure.sheet(at['N:1'], at['O:9'],
#                                         sheet_h_bonds=5))

#       Restrain the specified CA-CA distance to 10 angstroms (st. dev.=0.1)
#       Use a harmonic potential and X-Y distance group.
        rsr.add(forms.gaussian(group=physical.xy_distance,
                               feature=features.distance(at['CA:35'],
                                                         at['CA:40']),
                               mean=10.0, stdev=0.1))

a = MyModel(env,
            alnfile  = 'alignment.ali',     # alignment filename
            knowns   = '5fd1',              # codes of the templates
            sequence = '1fdx')              # code of the target
a.starting_model= 1                 # index of the first model
a.ending_model  = 1                 # index of the last model
                                    # (determines how many models to calculate)
a.make()                            # do homology modeling

 
 
 
----------------------------------------------------------
# Homology modeling by the automodel class
#
# Demonstrates how to build multi-chain models, and symmetry restraints
#
from modeller import *
from modeller.automodel import *    # Load the automodel class

log.verbose()

# Override the 'special_restraints' and 'user_after_single_model' methods:
class MyModel(automodel):
    def special_restraints(self, aln):
        # Constrain the A and B chains to be identical (but only restrain
        # the C-alpha atoms, to reduce the number of interatomic distances
        # that need to be calculated):
        s1 = selection(self.chains['A']).only_atom_types('CA')
        s2 = selection(self.chains['B']).only_atom_types('CA')
        self.restraints.symmetry.append(symmetry(s1, s2, 1.0))
    def user_after_single_model(self):
        # Report on symmetry violations greater than 1A after building
        # each model:
        self.restraints.symmetry.report(1.0)

env = environ()
# directories for input atom files
env.io.atom_files_directory = ['.', '../atom_files']

# Be sure to use 'MyModel' rather than 'automodel' here!
a = MyModel(env,
            alnfile  = 'twochain.ali' ,     # alignment filename
            knowns   = '2abx',              # codes of the templates
            sequence = '1hc9')              # code of the target

a.starting_model= 1                # index of the first model
a.ending_model  = 1                # index of the last model
                                   # (determines how many models to calculate)
a.make()                           # do homology modeling

Example: examples/automodel/twochain.ali


C; example for building multi-chain protein models

>P1;2abx
structureX:2abx:   1 :A:74 :B:bungarotoxin:bungarus multicinctus:2.5:-1.00
IVCHTTATIPSSAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNHPPKRQPG/
IVCHTTATIPSSAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNHPPKRQPG*

>P1;1hc9
sequence:1hc9:   1 :A:148:B:undefined:undefined:-1.00:-1.00
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG/
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG*