Re: [modeller_usage] divide__213E> Division by zero, during seq. search
To:
Subject: Re: [modeller_usage] divide__213E> Division by zero, during seq. search
From: J B Procter <>
Date: Tue, 10 Feb 2004 10:34:33 +0100
Organization: Zentrum Fuer Bioinformatik
Reply-to:
On Tue, 10 Feb 2004 09:15:53 +0100
Esben Jannik Bjerrum <> wrote:
> I'm currently blocked by an unusual problem. Running modeller
> for sequence search, it ends with a Divide__213E> Division by zero,
> My NR2BS1S2.ali
> >P1;NR2BS1S2
> sequence:NR2BS1S2:::::::0.00: 0.00
> qeddhlsiVtleeapfvivesvdplsgtcmrntvpcqkrivtenktdeepgyikkcckgf
> cidilkkisksvkftydlylvtngkhgkkingtwngmigevvmkraymavgsltineers
> evvdfsvpfietgisvmvskgtqvsglsdkkfqrpndfsppfrfgtvpngsternirnny
> aemhaymgkfnqrgvddallslktgkldafiydaavlnymagrdegcklvtigsgkvfas
> tgygiaiqkdsgwkrqvdlailqlfgdgemeelealwltgichne*
For superstitious reasons, perhaps, I usually use capital letters for
the amino-acids, and put the residue numbers in the
'sequence:NR2PBS1S2:.' line.
Your error looks like it is due to an alignment that is too small, since
it appears that only the 'V' is aligned, despite the obvious homology
between both sequences.
j.
_______________________________________________________________________
Dr JB Procter:Biomolecular Modelling at ZBH - Center for Bioinformatics
Hamburg http://www.zbh.uni-hamburg.de/staff.php