Dear users,
I am trying to produce a chimeric model for my protein. The first thing I want to do is to check the alignment I have.
When I tell Modeller to execute the "check_alignment" command, I get the following message:
rdpir___E> alignment sequence not found in PDB file: 1
./pXXXX.pdb
#######################################################################################################################################
The alignment I have is:
>P1;pXXXX
structureX:…
[View More]pXXXX:.::.:::::
CKPMSNFRF-GENHAIMGVAFTWVMALACAAPPLVGWS--RYIPEGMQC-SCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTH--------QGSDFGPIFMTIPAFFAKTSAVYNPVIYIMM*
>P1;pAveM
structure:pAveM:2::211:::::
-----------VRWAKLYSLVIWGCTLLLSSPMLV-----------------------------EVFTNMLLNVVGFLLPLSVITFCTMQ---------------------ERRATVLVLVVLLLFIICWLPFQISTFLDTL----------------VITQIASFMAYSNSCLNPLVYVIV*
>P1;Ali2
sequence:Ali2::::::::
VKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSL---IWEVFTNMLLNVVGFLLPLSVITFCTMQIMQVLRNNEMQKFKEIQT---ERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGILSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIV*
#######################################################################################################################################
Perhaps, something is wrong with file names or PDB codes.(I stored the pdb files as pXXXX.pdb)
Can somebody help me?
Thank you very much,
Paola
--
dott. Paola D'Alessio (PhD student)
Universita' degli Studi di Salerno
Dipartimento Scienze Farmaceutiche
via Ponte Don Melillo, 84084 Fisciano (Sa), Italy
tel.+39 089 962822; e-mail: pdalessio(a)unisa.it
[View Less]
The information in this message is private and confidential and is intended for the addressed
recipient only. You are receiving this special offer because your address was provided as someone
who might be interested in receiving investment news and opportunities. If you wish to be
excluded from any future mailings and/or not interested in the offer or you think you received it
by an error*, simply erase this message.
______________________________________________________
Dear Friend, …
[View More]Due to a copyrights filing requirement we can only send out a limited number of
invitations to work. We are offering a full or part-time position in various industries. As to
the salary, it's totally up to you, as you will be running your own business, the sky is the
limit. What you will see represents a completely legal money making businesses that anyone can
run to generate a significant residual income.
You will get unique opportunities. This is a genuine offer, not a chain letter, money-game,
telecom scheme, or any of the multitudes of dubious "business" offers that come through your
email box. These business opportunities will easily generate a residual income of $2,000 to
$6,000 every month with only a part-time commitment (about 10 hours per week). A full-time
commitment (about 30 hours per week), based on statistics gathered from our current clients (and
my own personal experience), will translate into an income of $10,000 or more per month!
This is the only source for legitimate information with a potential to become a successful
independently wealthy person. Please do not confuse our offer with illegal chain letter schemes
and neither is our offer an invitation to participate in a multi-level or network marketing
program.
Our program is the most legitimate, realistic independent job opportunities available today!
As we are only accepting a limited number of requests for Employment Guide and Kit in a given
month, therefore hurry to get yours as soon as possible.
The reason we charge you for this offer is because we are looking for serious people, who know
what they want and are looking for a job to start immediately. Otherwise, we would be loosing
money sending our packages just to anyone who responded to the offer.
(Your initial fee, in 94% of the cases, is fully refundable and/or doubled, depending on the type
of work you will choose.)
Here are some examples of the different fields available:
Professional Services * Computer Workers * Computer Program Designers * Typesetting Input
Operators * Data and Word Processors * Contract Programmers * Software Developers * Internet
Workers * Telecommuters * Secretarial Positions * Clerical Positions * Legal Transcribers *
Medical Transcribers * Foreign Language Transcribers * Data Entry * Policy Typists * Editors *
Commercial Reporters * Desktop Publishers * Bulk Mailers * General Office Workers * Customer
Service Positions * Answering Service * Fund Raisers * Auditors * Staff Coordinators * Product
Buyers * Program Directors * Sales Reps (All Kinds) * Human Resource Management * Career &
Financial Planners * Travel Agents * Accounting * Government Processors * Industrial Related
Workers * Wood Workers * Painters * Health Consultants * Weight Loss Consultants * Beauty
Consultants * Arts Related Jobs * Photographers * Graphic Artists * Designers * Calligraphers *
Illustrators * Crafts Related Jobs * Product Assemblers * Jewelry Making * Knitting * Macram� *
Embroidery * Sewing * Merchandisers * Distributors * Mail Order Representatives * Order
Processing Reps * Mystery Shoppers * $50 A Day to Shop * And much, much more
Below are just few companies that you might like working for:
AT&T, Amtrak, Apple Computer, Bell South, Bell Communications, Beneficial Corporation, Best
Western Hotels International, Blue Cross/Blue Shield, Citibank, The Federal Reserve Bank, Aetna,
Allstate, American Express, Honeywell, IBM, The United States General Services Administration,
The Federation of the Handicapped, Data Command, The Bureau of Office Services, The Computer
Secretary, The Computer Central Corporation, H&R Block, The 24 Hour Secretary, Certified
Translation Services, The Data General Corporation, The Federated Tax Service, The Home Office
Network, The Prime Computer Co., Hallmark Greeting Cards and many other Nation Wide Fortune 500
Companies routinely use qualified home workers.
--------------------------------------------------------------------
If you are interested in the above offer please print and fill out the form below and mail to the
address indicated:
Name:
Address:
E-mail:
[____] I am enclosing $28 U.S.(that's including $4.95 Shipping & Handling) for my Employment
Guide and Kit so I can start exploring the opportunities right away. Please allow 3-4 weeks for
processing.
[____] Money Order
(No US Postal Money Order)
[____] Cashier Check
Send To:
TYSS Company
Processing Dpt Offer-2101
15500 Erwin Street,PMB, Suite 104
Van Nuys, Ca 91411
=====================================================================
Also, if we receive your response in 5 business days you will receive a free bonus - our
exclusive Internet for Free brochure, valued $35 or more!
Hurry!
* residents of Washington State
[View Less]