November 2007 - modeller_usage

Fwd: validation and log file
by aesteves＠fcien.edu.uy 12 Nov '07

12 Nov '07

I still worried about validation. I know I have to read the model-default.log file to look for: objetive function and chose the one with the lowest(I did it; the DOPE pseudo-energy value and de value of GA341, and finally the restraint violations, but I did not find the third value and I dont know how to read violations. Can anybody help me to read the log file and find the information I need to validate my model? Thank you very much. Adriana ---------------------------------------------------------------- This message was sent using IMP, the Internet Messaging Program. ----- Fin del mensaje reenviado ----- ---------------------------------------------------------------- This message was sent using IMP, the Internet Messaging Program.

2 1

Writing out chain ID in the PDB
by Vadim Patsalo 12 Nov '07

12 Nov '07

Hello Modeller Users, I am building models in the way described in the basic tutorial. I noticed that the completed model PDB is missing the chain ID column. The template I am modelling from has only one chain, A. Here's an example: Template: ATOM 1 N SER A 2 -6.487 9.533 21.436 1.00 2.23 1SG 2 ATOM 2 CA SER A 2 -5.822 10.328 20.343 1.00 2.86 1SG 3 ATOM 3 CB SER A 2 -6.345 11.788 20.283 1.00 2.67 1SG 4 and model: ATOM 1 N SER 1 -0.662 11.979 19.810 1.00 65.26 1SG 2 ATOM 2 CA SER 1 0.191 12.970 19.122 1.00 65.26 1SG 3 ATOM 3 CB SER 1 -0.325 14.388 19.420 1.00 65.26 1SG 4 Is there a way to force Modeller to print the chain ID? I convert the resulting PDB to charmm format, and some unpleasantness follows because of the missing chain info. Thanks for your help! Vadim -- five.sentenc.es is a personal policy that all email responses regardless of recipient or subject will be five sentences or less. It's that simple.

2 1

ligand
by aesteves＠fcien.edu.uy 10 Nov '07

10 Nov '07

----- Mensaje reenviado de aesteves(a)fcien.edu.uy ----- Fecha: Sat, 10 Nov 2007 11:50:45 -0200 De: aesteves(a)fcien.edu.uy Responder-A: aesteves(a)fcien.edu.uy Asunto: ligand Para: modeller-care(a)salilab.org Hi friends of modeller list: Now, I want to model my protein with a ligand but the program says me that one of the alignment residue does not match with pdb residues. In this site there is a gap in the pdb sequence introduced during alignment since the target has an insertion. The same alignmet file was used to build the model without any problem!! What I have to do? Thank you again, and forgive me for too much questions, but I want to learn how to use Modeller!! Sincerely, Adriana ---------------------------------------------------------------- This message was sent using IMP, the Internet Messaging Program. ----- Fin del mensaje reenviado ----- ---------------------------------------------------------------- This message was sent using IMP, the Internet Messaging Program.

1 0

symmetry in automodel
by Gordon Wells 06 Nov '07

06 Nov '07

Is it still possible to add symmetry restraints to automodel in spectial_restraints? I used to be able to do this with pick_atoms, but now that "selection" has taken over I seem to be missing something. I define a new class as follows: segsize=??? class sym_model(automodel): def special_restraints(self, aln): sel1 = selection(self.residue_range ('1',str(segsize))).only_mainchain() sel2 = selection(self.residue_range (str(segsize+1),str(2*segsize+1))).only_mainchain() self.restraints.symmetry.append(symmetry(sel1,sel2,1.0)) But get the following output: File "model-dimer.py", line 41, in ? a.make() File "/usr/local/modeller9v2/modlib/modeller/automodel/automodel.py", line 99, in make self.homcsr(exit_stage) File "/usr/local/modeller9v2/modlib/modeller/automodel/automodel.py", line 423, in homcsr self.mkhomcsr(selection(self), aln) File "/usr/local/modeller9v2/modlib/modeller/automodel/automodel.py", line 506, in mkhomcsr self.special_restraints(aln) File "model-dimer.py", line 26, in special_restraints sel1 = selection(self.residue_range('1',str(segsize))).only_mainchain() File "/usr/local/modeller9v2/modlib/modeller/coordinates.py", line 71, in residue_range start = self.residues[start]._num File "/usr/local/modeller9v2/modlib/modeller/coordinates.py", line 183, in __getitem__ (self.offset, self.length, self.suffix)) File "/usr/local/modeller9v2/modlib/modeller/util/modutil.py", line 19, in handle_seq_indx int_indx = lookup_func(*args) File "/usr/local/modeller9v2/modlib/modeller/coordinates.py", line 56, in _indxres raise KeyError, ("No such residue: %s" % indx) Thanks in advance -- "He has yet to find out that what's in the public interest is not what the public is interested in." -- The Truth, Terry Pratchett -- Gordon Wells Bioinformatics and Computational Biology Unit Department of Biochemistry University of Pretoria

2 1

Re: [modeller_usage] Transfer_xyz question
by Ali Algarrous 06 Nov '07

06 Nov '07

I'm sorry but it seems I didn't explain myself clearer. What I asked for last time is different than what I'm asking now. This time I want the script to transfer the coordinates for aligned residues only and nothing that is not aligned. So the MSFIEKMIG in my sequance is not going to have any coordinates because it was not aligned with anything from my templae. I hope I explained myself better now. Regards, Ali -----Original Message----- >From Modeller Caretaker <modeller-care(a)salilab.org> Sent Mon 11/5/2007 2:34 PM To Ali Algarrous <algarra(a)uni.edu> Cc modeller_usage(a)salilab.org Subject Re: [modeller_usage] Transfer_xyz question Ali Algarrous wrote: > If i have the following alignment > >>P1;1ji4 > structureX:1ji4:FIRST:A:LAST:A:::: > MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEI---------Y > EEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRV-----KEETKTSFHSKDIF > KEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHL-- > -----A* > > >>P1;madeup > sequence:madeup::::::: > -------------------------------------------MSFIEKMIGS > LNDKREWKAMEARAKAL---PKEYHHAYKAIQKYMWTSGG--PTDWQDTKRIF > GGILDLFEEGAAEGKKVTDLTGE--D--VAAFCDELMKDTKTWMDKYRTKLND > SIGRD-* > > and i want to transfer the coordinates from my template to my sequence > without building the loops. How should I change my code so it would do > that for me?? What's wrong with the script you posted? Looks like it should do exactly what you want to do to me. And how does your question differ from that at http://salilab.org/archives/modeller_usage/2007/msg00200.html ? I thought that had already been resolved. Ben Webb, Modeller Caretaker -- modeller-care(a)salilab.org http://www.salilab.org/modeller/ Modeller mail list: http://salilab.org/mailman/listinfo/modeller_usage

2 1

Asking about energy minimization after initial model]
by Chiranjit Chowdhury 06 Nov '07

06 Nov '07

Dear Friends, I got my initial model for my protein using MODELLER 9v1 which was further assessed by DOPE potential in MODELLER to evaluate model fold and with the program PROCHECK and VERIFY3D. In Ramachandran plot my model showed 93.9% core 5.8% allow .0% gener .3% disall region and 3 bad contacts. Verify 3d data showed above 90% of the residues had an averaged 3D-1D score > 0.2. Please suggest whether I shall have to do energy minimization and if energy minimization is necessay also suggest how it is possible and which parameter I shall have to use for energy minimization. Best regards. -- Chiranjit Chowdhury Department of Biotechnology Indian Institute of Technology, Kharagpur West Bengal, India PIN: 721302

1 0

Transfer_xyz question
by Ali Algarrous 06 Nov '07

06 Nov '07

Hello, If i have the following alignment >P1;1ji4 structureX:1ji4:FIRST:A:LAST:A:::: MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEI---------Y EEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRV-----KEETKTSFHSKDIF KEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHL-- -----A* >P1;madeup sequence:madeup::::::: -------------------------------------------MSFIEKMIGS LNDKREWKAMEARAKAL---PKEYHHAYKAIQKYMWTSGG--PTDWQDTKRIF GGILDLFEEGAAEGKKVTDLTGE--D--VAAFCDELMKDTKTWMDKYRTKLND SIGRD-* and i want to transfer the coordinates from my template to my sequence without building the loops. How should I change my code so it would do that for me?? This is the code that i have been using. from modeller import * env = environ() env.libs.topology.read(file='$(LIB)/top_heav.lib') env.libs.parameters.read(file='$(LIB)/par.lib') aln = alignment(env, file='alignment.ali',align_codes=('1ji4', 'madeup')) mdl = model(env) mdl.generate_topology(aln['madeup']) # Assign the average of the equivalent template coordinates to MODEL: mdl.transfer_xyz(aln) # Get the remaining undefined coordinates from internal coordinates: mdl.build(initialize_xyz=False, build_method='INTERNAL_COORDINATES') # Write the final MODEL coordinates to a PDB file: mdl.write(file='madeup.pdb') Regards, Ali Algarrous

2 2

Re: [modeller_usage] DOPE applied to multichains
by Modeller Caretaker 02 Nov '07

02 Nov '07

DimitryASuplatov wrote: > Thanks for the answer. Could you paste me the link (to web or article, > the latter would be even better) to DOPE specification and evaluation > because I did not find it. the DOPE publication is #172 at http://salilab.org/publications/ which is Protein Science 15, 2507 - 2524, 2006. Ben Webb, Modeller Caretaker -- modeller-care(a)salilab.org http://www.salilab.org/modeller/ Modeller mail list: http://salilab.org/mailman/listinfo/modeller_usage

1 0

DOPE applied to multichains
by DimitryASuplatov 02 Nov '07

02 Nov '07

Hello, In 9v2 manual (as in all previous) it is insistently recomended to use .assess_dope() for single chains only. What exactly does it mean? 1/ Could I possibly apply dope to multichain proteins? 2/ How should I use dope on multichains? Should I split each chain to single pdb and apply dope for each one sepparately? Would this be correct? Should`t dope include chain-chain interactions? Thankyou very much for the program and for the answers!

2 1

Re: [modeller_usage] validation with procheck
by Michael Sadowski 01 Nov '07

01 Nov '07

Dear Adriana, I believe this website still works, although I've not tried it since July of this year. It runs Procheck and whatcheck. http://biotech.ebi.ac.uk:8400/cgi-bin/sendquery Regards, Michael ---------------------------------------------------------------------- Message: 1 Date: Mon, 29 Oct 2007 17:33:56 -0300 From: "Adriana Esteves" <aesteves(a)fcien.edu.uy> Subject: [modeller_usage] validation with procheck To: "Modeller lista" <modeller_usage(a)salilab.org> Message-ID: <CFEKJPEBLCOFMLEGBEBCKEJPCGAA.aesteves(a)fcien.edu.uy> Content-Type: text/plain; charset="iso-8859-1" Do anybody knows a web site to run procheck? ___________________________________________________________ Want ideas for reducing your carbon footprint? Visit Yahoo! For Good http://uk.promotions.yahoo.com/forgood/environment.html

1 0