modeller_usage

modeller_usage@salilab.org

3151 discussions

GA341 score vector - PS
by R K Belew 22 Aug '11

22 Aug '11

looking through Modeller's generated output: > % sequence identity : 8.397000 > Sequence length : 131 > Compactness : 0.393804 > Native energy (pair) : 26.327664 > Native energy (surface) : -0.742166 > Native energy (combined) : 0.798566 > Z score (pair) : -2.285661 > Z score (surface) : -2.854515 > Z score (combined) : -3.209596 > GA341 score : 0.040909 i'm now guessing it is probably the compactness,native energy and Z scores?

1 0

plot_profiles.py run error
by 刘吉元 22 Aug '11

22 Aug '11

2 1

I need some information about an salign module
by Ashish Runthala 15 Aug '11

15 Aug '11

Dear Modellers, The script salign_multiple_struc.py works on sub-optimal alignments as given on page http://computing.bio.cam.ac.uk/local/doc/modeller/node294.html Tell me, is this script similar to the consistency and sub-optimal alignment generation, as cited by Travis Wheeler for MAFFT, PROBCONS, TCOFFEE. Other than their hydrophobic gap penalties, what is the other difference focusing on alignment strategy between this script and these three servers. Thank you Ashish -- Ashish Runthala, Lecturer, Structural Biology Cell, Biological Sciences Group, BITS, Pilani Rajasthan, INDIA

2 1

ranking loop scores
by flavio seixas 15 Aug '11

15 Aug '11

Hi Ben, I wanto to carry out with loop refinement from the "best" model generated by modeller. However, the log file from loop.py script only ranks a modpdf score. I edited the script to generate other assessment scores as follow: m = MyLoop(env, inimodel='PROTEIN.B99990220.pdb', sequence='PROTEIN', assess_methods=(assess.DOPE, assess.GA341)) m.loop.starting_model= 1 # index of the first loop model m.loop.ending_model = 20 # index of the last loop model m.loop.md_level = refine.very_fast # loop refinement method m.make() # Get a list of all successfully built models from a.outputs ok_models = filter(lambda x: x['failure'] is None, a.outputs) # Rank the models by DOPE score key = 'DOPE score' ok_models.sort(lambda a,b: cmp(a[key], b[key])) # Get top model m = ok_models[0] print "Top model 1: %s (DOPE score %.3f)" % (m['name'], m[key]) m = ok_models[1] print "Top model 2: %s (DOPE score %.3f)" % (m['name'], m[key]) m = ok_models[2] print "Top model 3: %s (DOPE score %.3f)" % (m['name'], m[key]) m = ok_models[3] print "Top model 4: %s (DOPE score %.3f)" % (m['name'], m[key]) m = ok_models[4] print "Top model 5: %s (DOPE score %.3f)" % (m['name'], m[key]) However, the assess_methods seems bo be ignored and loopy.log file does not list the models ranked by DOPE socore. root@hercules:~/modeller/set7/loop# mod9.9 loop.py Could not find platform independent libraries <prefix> Could not find platform dependent libraries <exec_prefix> Consider setting $PYTHONHOME to <prefix>[:<exec_prefix>] 'import site' failed; use -v for traceback Traceback (most recent call last): File "loop.py", line 30, in ? ok_models = filter(lambda x: x['failure'] is None, a.outputs) TypeError: iteration over non-sequence root@hercules:~/modeller/set7/loop# Is there a problem with the way I set the scritp? Regards, Flavio

2 1

import pylab ImportError: No module named pylab
by 刘吉元 04 Aug '11

04 Aug '11

2 1

using SALIGN-error
by Nava Moran 02 Aug '11

02 Aug '11

dear Modeller, I pasted a fasta-format sequence in the "window", hit the "upload" button and got the following: "Sorry, your request was not processed due to the following reason: * directory (/modbase5/home/salign/todo/1299736963_SA_230/upload/unzip/) Core(10)_Helices is still tainted at /usr/lib/perl5/5.8.8/File/Find.pm line 837." this is the stuff I pasted: >nt_just-seq YPDDRWYKIWEKFILIWAIYSSFFTPMEFAFFKGLPRKLFLLDICGQ IAFLVDIVVQFFVAYRDSQTYKMVHKRTPIALRYLKTHFILDFLSCMPWDNIYKAAGKKE GLRYLLWIRLSRVRRVNDFFQKMEKDIRINYLFTRILKLIV thanks in advance for an explanation how to use this "paste" nava *

2 1

Regarding Optimal Alignment
by Ashish Runthala 02 Aug '11

02 Aug '11

Dear Modellers, Check out this alignment 3KIJA>------FLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLT* 2P31A>------------QDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFT* 2GS3A>TENLYFQSMRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQGGKT* 2OBIA>------DDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKT* TARGET>---ENLYFQSMINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLT* (I have given a space initially so that you can easily understand the alignment) Will somebody guide me how to incorporate the distant conserved chunk ENLYFQSM from "2GS3A" template without making the shifted alignments just to satisfy this constraint. Is there any way to use the chunk from it along with the other conserved aligned motifs. I know Sir Benn will definitely answer my query. Thanks Ashish Ashish Runthala, Lecturer, Structural Biology Cell, Biological Sciences Group, BITS, Pilani Rajasthan, INDIA

2 1

Re: [modeller_usage] modeller_usage Digest, Vol 10, Issue 108
by Ashish Runthala 30 Jul '11

30 Jul '11

Dear Mustafa, As such energy can't discriminate between close decoys, Normalized_dope gives a better idea. You may see the effect of each of the Modeller assessment score through your modeling script this way. a = automodel(env, alnfile = '------', knowns = ('---', '---'), sequence = 'target', assess_methods=(assess.DOPE, assess.GA341,assess.normalized_dope)) Use a redirection operator > to save modeling result. Then use the trajectory of these values in your modeling. You will get your answer if you try modeling a known structure target, so that you can affirm model evaluation through GDT scores. Good Luck, Ashish Ashish Runthala, Lecturer, Structural Biology Cell, Biological Sciences Group, BITS, Pilani Rajasthan, INDIA ----- Original Message ----- From: "modeller usage-request" <modeller_usage-request(a)salilab.org> To: "modeller usage" <modeller_usage(a)salilab.org> Sent: Saturday, July 30, 2011 12:47:57 PM GMT +05:30 Chennai, Kolkata, Mumbai, New Delhi Subject: modeller_usage Digest, Vol 10, Issue 108 Send modeller_usage mailing list submissions to modeller_usage(a)salilab.org To subscribe or unsubscribe via the World Wide Web, visit https://salilab.org/mailman/listinfo/modeller_usage or, via email, send a message with subject or body 'help' to modeller_usage-request(a)salilab.org You can reach the person managing the list at modeller_usage-owner(a)salilab.org When replying, please edit your Subject line so it is more specific than "Re: Contents of modeller_usage digest..." Today's Topics: 1. Re: Good Quality Score (Modeller Caretaker) 2. Regarding Proper Alignment (Ashish Runthala) 3. Re: Regarding Proper Alignment (Modeller Caretaker) 4. Selection of Model (MUSTAFA BUGHIO) ---------------------------------------------------------------------- Message: 1 Date: Thu, 28 Jul 2011 17:18:07 -0700 From: Modeller Caretaker <modeller-care(a)salilab.org> Subject: Re: [modeller_usage] Good Quality Score To: Brian Tsui <btsui17(a)yahoo.com> Cc: "modeller_usage(a)salilab.org" <modeller_usage(a)salilab.org> Message-ID: <4E31FC3F.5010601(a)salilab.org> Content-Type: text/plain; charset=ISO-8859-1; format=flowed On 7/26/11 8:33 PM, Brian Tsui wrote: > In the Madhusudhan paper, the cutoff was at least 70% for a SO of 3.5 A. Do you mean the SO was 70% for a cutoff of 3.5A? > What number does that correspond to in the salign output? The percentage of equivalent (i.e. within the cutoff) positions is the qscorepct member of the SalignData object returned by salign(). Set the cutoff with the rms_cutoff argument. And make sure you have QUALITY in the output argument. > For the quality score, is there an objective number that I can use for > every alignment to see whether it is good or not? As I said, only for structure alignments. > Lastly, for "iterative salign," is it recommended to run the regular > version first or just jump straight to using the iterative salign? The > Madhusudhan paper seems to forgo the use of iterative salign if the > alignment is 70% at a SO of 3.5 I'm assuming you're looking at fig 1 in the paper here. There are three iterative procedures within that flowchart; one of them is skipped if the first procedure (simpler alignment using a subset of features) found a reasonable starting guess for the last procedure (structural alignment). The second procedure is simply an attempt to improve this guess if the first failed. Ben Webb, Modeller Caretaker -- modeller-care(a)salilab.org http://www.salilab.org/modeller/ Modeller mail list: http://salilab.org/mailman/listinfo/modeller_usage ------------------------------ Message: 2 Date: Fri, 29 Jul 2011 12:19:49 +0530 (IST) From: Ashish Runthala <ashishr(a)bits-pilani.ac.in> Subject: [modeller_usage] Regarding Proper Alignment To: modeller <modeller_usage(a)salilab.org> Message-ID: <30722239.171381311922189682.JavaMail.root(a)mailserver.bits-pilani.ac.in> Content-Type: text/plain; charset=utf-8 Dear Modellers, May somebody tell me the logic of using rms_cutoff=3.5 while comparing and aligning multiple structures. Even when you alter, no difference come up in the generated model. Is this upper bound a relaxed in every modeling case. It may not be so, when same family proteins are aligned. So this strict upper bound on C? distance may leave several large chunks unaligned. Variable gap penalty makes the alignment correct through flexible allowed superposition, but why changing rms_cutoff didn't generate better models, not even 0.1 GDT_TS improvement was not observed. Thanks Ashish Ashish Runthala, Lecturer, Structural Biology Cell, Biological Sciences Group, BITS, Pilani Rajasthan, INDIA ------------------------------ Message: 3 Date: Fri, 29 Jul 2011 15:43:30 -0700 From: Modeller Caretaker <modeller-care(a)salilab.org> Subject: Re: [modeller_usage] Regarding Proper Alignment To: Ashish Runthala <ashishr(a)bits-pilani.ac.in> Cc: modeller <modeller_usage(a)salilab.org> Message-ID: <4E333792.1070802(a)salilab.org> Content-Type: text/plain; charset=UTF-8; format=flowed On 7/28/11 11:49 PM, Ashish Runthala wrote: > May somebody tell me the logic of using > rms_cutoff=3.5 while comparing and aligning multiple structures. Even > when you alter, no difference come up in the generated model. Changing rms_cutoff will not change the alignment. The cutoff is simply the distance below which two residues are considered to be structurally equivalent when aligned, so it will only affect measures such as the structural overlap (and quality score). Ben Webb, Modeller Caretaker -- modeller-care(a)salilab.org http://www.salilab.org/modeller/ Modeller mail list: http://salilab.org/mailman/listinfo/modeller_usage ------------------------------ Message: 4 Date: Sat, 30 Jul 2011 12:17:54 +0500 From: MUSTAFA BUGHIO <mustafab4(a)gmail.com> Subject: [modeller_usage] Selection of Model To: modeller_usage(a)salilab.org Message-ID: <CALHZR253S3mXhzH-=j4a8nM10__Tv+F+G2DNigfJHgZu=BEPjQ(a)mail.gmail.com> Content-Type: text/plain; charset="iso-8859-1" Dear Ben I wanna repeat the question already asked by some one regarding the selection of best model criterion. I have developed pentamer Structure using model-multichain.py command i want to know on what basis i should select the best model out of 20 models. I have checked both modeller objective function scores and also Dope score but there i could not observe any correlation between the two. Can i get your input in this regard Regards -- MUSTAFA BUGHIO Junior Research Fellow Lab # P-133 Computational Medicinal Chemistry and Drug Design Panjwani Center For Molecular Medicine and Drug Research, International Center for Chemical Sciences, University of Karachi, Karachi 75270 Pakistan, +923313425010

1 0

Selection of Model
by MUSTAFA BUGHIO 30 Jul '11

30 Jul '11

Dear Ben I wanna repeat the question already asked by some one regarding the selection of best model criterion. I have developed pentamer Structure using model-multichain.py command i want to know on what basis i should select the best model out of 20 models. I have checked both modeller objective function scores and also Dope score but there i could not observe any correlation between the two. Can i get your input in this regard Regards -- MUSTAFA BUGHIO Junior Research Fellow Lab # P-133 Computational Medicinal Chemistry and Drug Design Panjwani Center For Molecular Medicine and Drug Research, International Center for Chemical Sciences, University of Karachi, Karachi 75270 Pakistan, +923313425010

1 0

Regarding Proper Alignment
by Ashish Runthala 29 Jul '11

29 Jul '11

Dear Modellers, May somebody tell me the logic of using rms_cutoff=3.5 while comparing and aligning multiple structures. Even when you alter, no difference come up in the generated model. Is this upper bound a relaxed in every modeling case. It may not be so, when same family proteins are aligned. So this strict upper bound on Cα distance may leave several large chunks unaligned. Variable gap penalty makes the alignment correct through flexible allowed superposition, but why changing rms_cutoff didn't generate better models, not even 0.1 GDT_TS improvement was not observed. Thanks Ashish Ashish Runthala, Lecturer, Structural Biology Cell, Biological Sciences Group, BITS, Pilani Rajasthan, INDIA

2 1

Jump to page:

2024

2023

2022

2021

2020

2019

2018

2017

2016

2015

2014

2013

2012

2011

2010

2009

2008

2007

2006

2005

2004

2003

2002

2001

2000

1999

1998

1997

modeller_usage