modeller_usage

modeller_usage@salilab.org

3151 discussions

Amount of models
by HERBERT MAX VENTHUR PE¥A 24 May '13

24 May '13

Hello I've read papers where the amount of models generated are not indicated, however, indicate that more than 1 model was obtained. The script of the tutorial of modeller provides 5 models. My question is, Is there any effect in the quality of the model if I generate several models? for example, 200 models versus 5 models? Thank you Best regards Herbert -- *Herbert Venthur Peña Profesor de Estado en Ciencias con Mención en Química* *Estudiante de Doctorado en Ciencias de Recursos Naturales * *Laboratorio de Ecología Química Universidad de La Frontera Temuco, Chile * *08-3104992*

2 1

Urgent Query . Please do reply. Thanks a ton.
by Priya Chaudhary 21 May '13

21 May '13

Using automodel model-full python script, 1. Do we get any changes in side chain conformations or coordinates if the query sequence is perfectly aligned with template sequence at sequence level. Because upon point mutations, there is no change in sequence alignment. Whole query sequence is perfectly aligned with template. I calculated no. of contacts of wild type residues and mutant residues, there is no change at all. I used only distance between C-alpha atoms(CA) while calculating . Is there any change in side chain conformations in the modeled structures by using this script. 2. Can I get to know the details of a.make() and a.auto_align() commands used in this script. I WANT TO KNOW STEP WISE THE INSIDE DETAILS AND WORKING OF THIS SCRIPT. PLEASE HELP. URGENT !!! Please bear up with me as I don't know Python.. *Example: examples/automodel/model-full.py<http://salilab.org/modeller/9.11/examples/automodel/model-full.py> * # A sample script for fully automated comparative modeling from modeller import * from modeller.automodel import * # Load the automodel class log.verbose() env = environ() # directories for input atom files env.io.atom_files_directory = ['.', '../atom_files'] a = automodel(env, # file with template codes and target sequence alnfile = 'alignment.seg', # PDB codes of the templates knowns = ('5fd1', '1fdn', '1fxd', '1iqz'), # code of the target sequence = '1fdx') a.auto_align() # get an automatic alignment a.make() # do homology modeling

2 1

Residues missing !!! How to specify NMR MODEL - 2
by Priya Chaudhary 21 May '13

21 May '13

Sir I used automodel - model-full.py script. I have NMR Structure. Some residues are missing in NMR MODEL no.1. I wish to use NMR Model No 2 as template. How and where to make necessary changes ?

2 1

HETATM modelling query -reg
by venkatesh s 21 May '13

21 May '13

Respected Sir i am trying to add my model one zinc HETATM, but my efforts are failed , *iam getting *ATOM in my file pdb instead HETATM in the template structure Experimentally solved Residues Region *191-609* , protein Total Length: *419* in that Five residue are Missing Residue Here i mentioned Alignment file >P1;2DW0 structureX:2DW0.pdb: 196 :A:+414 :A:MOL_ID 1; MOLECULE CATROCOLLASTATIN; CHAIN A, B; FRAGMENT RESIDUES 191-609; SYNONYM VAP2, VASCULAR APOPTOSIS-INDUCING PROTEIN-2, CATROCOLLASTATIN/VAP2B:MOL_ID 1; ORGANISM_SCIENTIFIC CROTALUS ATROX; ORGANISM_COMMON WESTERN DIAMONDBACK RATTLESNAKE; ORGANISM_TAXID 8730: 2.15: 0.17 PFRFVELVLVVDKAMVTKNNGDLDKIKTRMYEIVNTVNEIYRYMYIHVALVGLEIWSNEDKITVKPEAGYTLNAF GEWRKTDLLTRKKHDNAQLLTAIDLD-RVIGLAYVGSMCHPKRSTGIIQDYSEINLVVAVIMAHEMGHNLGINHD SGYCSCGDYACIMRPEISPEPSTFFSNCSYFECWDFIMNHNPECILNEPLGTDIISPPVCGNELLEVGEECDCGT PENCQNECCDAATCKLKSGSQCGHGDCCEQCKFSKSGTECRASMSECDPAEHCTGQSSECPADVFHKNGQPCLDN YGYCYNGNCPIMYHQCYDLFGADVYEAEDSCFERNQKGNYYGYCRKENGNKIPCAPEDVKCGRLYCKDNSPGQNN PCKMFYSNEDEHKGMVLPGTKCADGKVCSNGHCVDVATAY.* >P1;TvLDH sequence:TvLDH: : : : ::: 0.00: 0.00 P-RYIELVIVADRAMVTKNNGDLTAIRTWVHQIVNDMTVMYRDLNIHITLAAVVIWNKRDLITVTSSAEDTLNLF GTWRETKYLKHRKHDNAQLLTGIILDDDTIGLAYVGGMCDPKKSVGIIEDHSTEHLLVAATMAHEMGHNLGMNHD ANQCNCGANGCVMSATLTEQTSYQFSDCSKDEYQNYLTDHNPQCILNQPLRTD-T-P-VSRNELLQ-NSAHPC-- --------CDPVTCQPK--RFCVSGPCCENCQFVRAGTVCNPAKGD-WMDDYCTGISSDCPRNPL---------- -----NGFR------------------------------------------------------------------ ----------------------------------------.* and Model Ligand python script which i used as followed # Homology modeling with ligand transfer from the template from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.', '../atom_files'] # Read in HETATM records from template PDBs env.io.hetatm = True a = automodel(env, alnfile = 'TvLDH-2DW0A.ali', # alignment filename knowns = '2DW0', # codes of the templates sequence = 'TvLDH') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 5 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling kindly give provide your valuable suggestion regarding error -- Regards,* *S.VENKATESH,

2 1

Evaluating models with procheck
by HERBERT MAX VENTHUR PE¥A 21 May '13

21 May '13

Hello My name is Herbert Venthur, I'm PhD student from Universidad de La Frontera, Chile. I'm new and beginner with modeller, however, I can model a protein structure using the basic tutorial of modeller. The model structure that I have, I submitted to ProCheck to evaluate the model, my question is: Results indicate a 95% of residues in favoured regions. That valuew, it is enough to have a suitable model?, Could I perform a docking with this model then? Thank your very much Best regards Herbert -- *Herbert Venthur Peña Profesor de Estado en Ciencias con Mención en Química* *Estudiante de Doctorado en Ciencias de Recursos Naturales * *Laboratorio de Ecología Química Universidad de La Frontera Temuco, Chile * *08-3104992*

2 1

Fwd: Customised Modeling - Template is NMR Structure
by Priya Chaudhary 10 May '13

10 May '13

Respected Sir I am new user of Modeller. *I don't have any background in python.* I have to use a template, whose PDB ID is 1APS. It is *NMR Model *with four models. I have to use only *first model of this NMR* structure. For this template, I have *50 Query sequences* in 50 separate ".fasta files" in PIR FORMAT. *Description of PIR Format of Query sequences:* *First line: *>1APS_1; Mutant_Y15M *Second Line:* I think this line is optional - I HAVE OMITTED THIS LINE. My second line is PROTEIN SEQUENCE in Capital letters ending with " * ". Can you guide me with* steps* of how to model 50 Query sequences with template 1APS (first model). I am mailing *ATTACHMENT* (in both .zip and .tar.gz format) containing 50 Query sequences and 1APS PDB file downloaded from Protein Databank. It would be of great help. Thanks a ton. Regards Priya

2 1

Re: [modeller_usage] modeller_usage Digest, Vol 12, Issue 17
by aixintiankong 09 May '13

09 May '13

Dear, thanks for you help. should i use the the entire second template(loop is disordered) sequence or only part of the disordered sequence to aglian? >Message: 1 >Date: Fri, 03 May 2013 10:31:56 -0700 >From: Modeller Caretaker <modeller-care(a)salilab.org> >To: aixintiankong <aixintiankong(a)126.com> >Cc: modeller_usage(a)salilab.org >Subject: Re: [modeller_usage] how to build the loop of protein model > using modeller >Message-ID: <5183F48C.7010601(a)salilab.org> >Content-Type: text/plain; charset=ISO-8859-1; format=flowed > >On 4/29/13 8:25 PM, aixintiankong wrote: >> i don't know how to build a model that the protein, NAD+ and ligand >> coexsit and the loop of protein is disordered. > >One way to do this would be to align your model sequence with the first >template (loop is helix) for the entire sequence except the loop, and >the second template (loop is disordered) for the loop: >http://salilab.org/modeller/9.11/FAQ.html#1 > >Another way would be to just use the first template, and just unalign >the loop so Modeller builds it without template information: >http://salilab.org/modeller/9.11/FAQ.html#2 > > Ben Webb, Modeller Caretaker >-- >modeller-care(a)salilab.org http://www.salilab.org/modeller/ >Modeller mail list: http://salilab.org/mailman/listinfo/modeller_usage

2 1

Error with the Mutate script
by Arjun Ray 08 May '13

08 May '13

Dear Sir, I am trying to mutate a residue THR61. Using the script provided on the website, I am getting following error: rayarjun$ python /usr/bin/mutate.py 1AV1.pdb 61 THR A > 1AV1.log File "/usr/bin/mutate.py", line 36 def refine(atmsel): ^ IndentationError: unindent does not match any outer indentation level Could you kindly help identifying the cause of it? Regards Arjun

2 3

change restraints relative weights
by Pietro Sormanni 03 May '13

03 May '13

dear Users, I am sorry for the naif question, but is there a way to change the relative importance of restraints? I am trying to add a secondary structure (both strand and sheet for H bonds) restraints to a model, in a region that do not align on the template structure (hence it shouldn't contain homology derived restraints). However only a few (up to 2) hydrogen bonds are formed rather than the whole beta sheet. In case you wish to delve further into this I attach at the end the piece of code that I use to add the restraints: Thank you very much for your help. Regards, Pietro from modeller import * from modeller.automodel import * # Load the automodel class # i tried also with automodel but there was no significant difference mdl = loopmodel(env, alnfile=already_done_alignment_filename, \ knowns = pdb_id, sequence = seq_id, \ loop_assess_methods=(assess.DOPE, assess.normalized_dope), \ assess_methods=(assess.DOPE, assess.normalized_dope) ) mdl.make_initial_model(aln) # Construct typical comparative modeling restraints mdl.mkhomcsr(selection(mdl), aln) mdl.restraints.add(secondary_structure.strand(mdl.residue_range('102:A', '108:A'))) # i know both of these regions are do align on anything (chain B is actually a 7 residues peptide I am adding, should be free to move anywhere). The residue numbering is read from initial model generated above mdl.restraints.add(secondary_structure.strand(mdl.residue_range('125:B:', '131:B'))) mdl.restraints.add(secondary_structure.sheet(mdl.atoms['N:102:A'], mdl.atoms['O:131:B'],sheet_h_bonds=-6)) mdl.restraints.make(selection(mdl), restraint_type='stereo', spline_on_site=False) mdl.restraints.condense() mdl.restraints.write(mdl.csrfile) # make the model env.edat.nonbonded_sel_atoms=1 # so that the selection interacts energetically with the unselected region. Actually I don't select anything manually, I added it just to be sure.. mdl.outputs = [] atmsel = mdl._check_select_atoms() mdl.multiple_models(atmsel) mdl.write_summary(mdl.outputs, 'models')

2 1

how to build the loop of protein model using modeller
by aixintiankong 03 May '13

03 May '13

Dear, The last email have some errors please see this one. In my system ,the loop is part of the active pocket of the protein. when the ligand is absent, the loop is disordered. if the ligand is present , the loop can transform into helix. In order to simulate the disordered loop transform into helix , i should build a model that the ligand and cofactor are in the disoreded loop site. In my system, there is a NAD+ cofactor in the active site and interact with the ligand.when the ligand and cofactor NAD+ coexist, the disordered loop can transform into helix. In the PDB(protein date base) i find the complex with the liand,NAD+ and the state of the loop is helix. i also find a structure of the protein without the liand, NAD+ and the state of the loop is disordered. The sequences similarity of the two structure is 100% and the RMSD between the two structures of the protein is 0.275 . i don't know how to build a model that the protein, NAD+ and ligand coexsit and the loop of protein is disordered. could give me some advice and tell me how to do it detailed? thank you very much.

2 1

Jump to page:

2024

2023

2022

2021

2020

2019

2018

2017

2016

2015

2014

2013

2012

2011

2010

2009

2008

2007

2006

2005

2004

2003

2002

2001

2000

1999

1998

1997

modeller_usage