[modeller_usage] missing residues

hi,

I have a dimer protein with missing residues in both subunits.

I have the target sequence, the original protein pdb with missing gaps * (a.pdb* resolution 3.58 Xray structure)and another pdb of the same protein with missing residues included (*b.pdb* resolution 3.5 electron diffraction)

So i have to add missing residues with b.pdb as the template and rest of the protein exact to a.pdb)

In the given example:

>P1;1qg8structureX:1qg8: 2 :A: 256 :A:undefined:undefined:-1.00:-1.00PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLN---DIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYIT--------------EFVRNLPPQRNCRELRESLKKLGMG*>P1;1qg8_fillsequence:::::::::PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNENRDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITDQSIHFQLFELEKNEFVRNLPPQRNCRELRESLKKLGMG*

Here what extra alignment should be added if i have a pdb(*b.pdb*) with missing residues included which can be used as a template(same sequence).

Also can i add missing residues in both A and B units simultaneously.

Thanking you