modeller_usage

modeller_usage@salilab.org

2 participants
3148 discussions

DNA nucleotide protein modeling
by Rana Rehan Khalid 26 Apr '21

26 Apr '21

Dear Modeller Users I want to model my receptor protein with single nucleotide probes. For exp: receptor ARG residue has interaction with adenine e, So I want to keep adenine in close proximity to receptor ARG. We have done the same thing for receptor against single residue probe (mean single aa residues e.i ALA LYS or ARG residues) But now we want to do this with a single nucleotide probe. In the case of protein, we tried this to generate a PIR file. here is the files >P1;PROBE_PLUS_RECEPTOR sequence:none::.::.:::: RYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMRKQE/RKP* #RKP mean arginine lysine proline etc nut we choose only middle one K >P1;REC # here we have receptor structure sequence structureX:rec.reformat.pdb:FIRST: :LAST: :::: RYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMRKQE/---* #here we have receptor with blank probes --- (for three residues) >P1;CENTER_RES #here we choose middle residue structure while our receptor is -------------- structureX:temp_centerRes_full.pdb:FIRST: :LAST: :::: --------------------------------------/-K-* __________________________________Modeller script___________________________________________ # Comparative modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class from modeller.scripts import complete_pdb log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.'] env.libs.topology.read(file='$(LIB)/top_heav.lib') env.libs.parameters.read(file='$(LIB)/par.lib') mdl=complete_pdb(env,'temp_centerRes_reduced.pdb') # fill rest of residue from 2 given atoms mdl.write('temp_centerRes_full.pdb', model_format='PDB') # selected atoms do not feel the neighborhood #env.edat.nonbonded_sel_atoms = 2 env.io.hetatm = True a = automodel(env, alnfile = 'temp_alignment.ali', # alignment filename knowns = ('CENTER_RES', 'REC'), # codes of the templates sequence = 'PROBE_PLUS_RECEPTOR') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model a.make(exit_stage=2) # do the actual comparative modeling, exit w/o optimization # output: pdbfile PROBE_PLUS_RECEPTOR.ini ____________________________________________________________________________ This same script also work fine for RNA nucleotides here are the results >P1;PROBE_PLUS_RECEPTOR sequence:none::.::.:::: RYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQE/g* >P1;REC structureX:rec.reformat.pdb:FIRST: :LAST: :::: RYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQE/-* >P1;CENTER_RES structureX:temp_centerRes_full.pdb:FIRST: :LAST: :::: ----------------------------------------------------------/g* script is this # Comparative modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class from modeller.scripts import complete_pdb log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.'] env.libs.topology.read(file='$(LIB)/top_heav.lib') env.libs.parameters.read(file='$(LIB)/par.lib') mdl=complete_pdb(env,'temp_centerRes_reduced.pdb') # fill rest of residue from 2 given atoms mdl.write('temp_centerRes_full.pdb', model_format='PDB') # selected atoms do not feel the neighborhood #env.edat.nonbonded_sel_atoms = 2 a = automodel(env, alnfile = 'temp_alignment.ali', # alignment filename knowns = ('CENTER_RES', 'REC'), # codes of the templates sequence = 'PROBE_PLUS_RECEPTOR') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model a.make(exit_stage=2) # do the actual comparative modeling, exit w/o optimization # output: pdbfile PROBE_PLUS_RECEPTOR.ini I used naming for RNA nucleotides are GUA CYT THY ADE see the final model in attachment this works fine for RNA nucleotides ////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// I apply same thing again with DNA Nucleotides its gives me error, I used following names for DNA Resi DADE DGUA DCYT DTHY # I also want to ask is this right to use DADE DCYT etc or modeller recognise these namings DT, DA, DG, DC here is alignment >P1;PROBE_PLUS_RECEPTOR sequence:none::.::.:::: RYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQE/l* >P1;REC structureX:rec.reformat.pdb:FIRST: :LAST: :::: RYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQE/-* >P1;CENTER_RES structureX:temp_centerRes_full.pdb:FIRST: :LAST: :::: ----------------------------------------------------------/l* modeller script is same as i pasted above error is this Read the alignment from file : temp_alignment.ali Total number of alignment positions: 59 # Code #_Res #_Segm PDB_code Name ------------------------------------------------------------------------------- 1 CENTER_RE 1 1 temp_center 2 REC 58 1 rec.reforma 3 PROBE_PLU 59 2 none check_a_343_> >> BEGINNING OF COMMAND openf___224_> Open temp_centerRes_full.pdb Dynamically allocated memory at amaxcoordinates [B,KiB,MiB]: 495379 483.769 0.472 Dynamically allocated memory at amaxstructure [B,KiB,MiB]: 495379 483.769 0.472 read_te_291E> Sequence difference between alignment and pdb : x (mismatch at alignment position 1) Alignment l PDB . Match Alignment residue type 50 (l, DGUA) does not match pdb residue type 67 (., DGU), for align code CENTER_RES (atom file temp_centerRes_full.pdb), pdb residue number "1", chain "" Please check your alignment file header to be sure you correctly specified the starting and ending residue numbers and chains. The alignment sequence must match that from the atom file exactly. Another possibility is that some residues in the atom file are missing, perhaps because they could not be resolved experimentally. (Note that Modeller reads only the ATOM and HETATM records in PDB, NOT the SEQRES records.) In this case, simply replace the section of your alignment corresponding to these missing residues with gaps. read_te_288W> Protein not accepted: 1 CENTER_RES Please guide thanks RNA nucleotide model is attached. Best ray

2 1

SequenceMismatchError when adding missing residues in LoopModel()
by Steven Truong 07 Apr '21

07 Apr '21

Dear Ben and Modeller Mailing List, Hello, I was hoping to get some help on an error I get when trying to add missing residues to a structure using the AutoModel/LoopModel classes. The error looks like: x (mismatch at alignment position 9) Alignment NSFTRVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHNPVLPFNDGVYFASTKSNIIRGWI PDB NSFTRGVYYPDKVFRSSVL.STQDLFLPFFSNVTWF.AI.VSGTNGTKRFDNPVLPFNDG Match ***** * * * Alignment residue type 18 (V, VAL) does not match pdb residue type 6 (G, GLY), for align code 6z43 (atom file structure_aligned), pdb residue number " 35", chain "A" When I check my alignment file, I can begin to see what’s going on. Here is the first entry of the alignment file: >P1;6z43 structureM:structure_aligned:27:A:+3600:C:::-1.00:-1.00 --------------------------AYTNSFTR-VYYPDKVFRSSVLHSTQDLFLPFFS NVTWFH--------------NPVLPFNDGVYFAST >P1;6z43_fill sequence:6z43_fill:.:.:.:.:::: MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFAST It appears that Modeller does not recognize the dashes “-“ as actual missing residues. Instead, it appears to read the alignment as NSFTR()V…, rather than NSFTRG. However, isn’t the dash supposed to signal AutoModel/LoopModel to treat that as a missing residue to fill? Thank you for your help! Best wishes, Steven Truong sdt45(a)cam.ac.uk<mailto:sdt45@cam.ac.uk> Cambridge University

2 6

Adding glycans in AutoModel?
by Steven Truong 19 Mar '21

19 Mar '21

Dear Modeller Mailing List, I was hoping to ask if there is a way to automate glycan-building in Modeller. I’ve been able to get all residues/atoms built using AutoModel. However, I lose the glycan information when using AutoModel. Is there another program that interfaces well with Modeller, or is there a class in Modeller that can add glycans at known positions (e.g. if I know NAG is attached to residue 6, can I add that to the PDB output somehow?). Thank you! Steven Truong sdt45(a)cam.ac.uk<mailto:sdt45@cam.ac.uk> Cambridge University

2 1

Modeller 10.1 release
by Modeller Caretaker 18 Mar '21

18 Mar '21

A new version of Modeller, 10.1, is now available for download! Please see the download page at https://salilab.org/modeller/ for more information. If you have a license key for Modeller 8 or 9, there is no need to reregister for Modeller 10.1 - the same license key will work. (It won't do any harm to reregister if you want to, though!) 10.1 is a minor update that adds support for Apple Silicon. The Mac installer (dmg file) is now universal and will work on both Intel Macs and the new Apple Silicon (M1 or ARM64) Macs. The Homebrew Modeller package also works on both Intel and Apple Silicon Macs. If you encounter bugs in Modeller 10.1, please see https://salilab.org/modeller/10.1/manual/node10.html for information on how to report them. Note: you are receiving this email either because you subscribed to the modeller_usage mailing list, or you provided this address when you requested a Modeller license and you ticked the "notify me of new releases" box. In the latter case, if you no longer wish to receive announcements of new Modeller releases, simply unsubscribe from the modeller_announce mailing list, or reply to this email and let us know. Ben Webb, Modeller Caretaker -- modeller-care(a)salilab.org https://salilab.org/modeller/ Modeller mail list: https://salilab.org/mailman/listinfo/modeller_usage

1 0

query regarding alignment
by anuricha sharma 15 Mar '21

15 Mar '21

Hello sir, I have a query regarding the alignment, that how can I align my two pdb structures and one query sequence(xyz.ali) together using basic modelling, I am unable to to do alignment using two models and one query sequence in basic modelling as it aligns only one model and one query sequence, can you suggest any changes that I need to do in my align2d.py file. ReplyForward Sent from Mail for Windows 10

2 1

can I add ambiguous restraints to modeller
by Li Xue 13 Mar '21

13 Mar '21

Hello all, Does modeller accept ambiguous restraints? For example, I know there is helix in a region but I am not sure where it starts. Best, Li

3 6

Quick Question on Automodel
by Pedro Guillem 08 Mar '21

08 Mar '21

Hello all, I'm trying to model from a known template (ident 37%). The template is missing the first 3 residues in the structure. - I start reading the template at position 4. - I add 3 dashes to the beginning of the template to compensate for the missing residues. (otherwise I get a "residue mismatch" error from modeller) Now, my alignment needs 3 additional gaps at the start of the template. No matter what I do, adding 6 dashes to the beginning of the template (3 for the missing residues and 3 extra for my alignment) has no effect on the outcome and the model doesn't align with the template in the way I expect. Here is a bit of my ali file. I want the TRL of the template to align with the TRM of the sequence. When it finishes, the position of TRM has a different offset in relation to TRL Am i doing something wrong here? >P1;template structureX:template:4:A:330:A:xxxxx:xxxxxxx:2.30:0.211 ------TR*L*......................rest of seq* >P1;seq sequence:seq:.:.:.:.:::: EAARRRTR*M*........ rest of seq* Thanks in advance. Pedro

2 4

remodelling a fragment of protein using different template.
by Yogesh Sharma 16 Feb '21

16 Feb '21

greetings readers, I am trying to model a protein with low homology. I have used ab initio methods to get a starting structure. but i want to remodel first 50-100 residues according to a different PDB template. is it possible to do so using modeller? please give some suggestions *Yogesh Sharma*

2 1

Installation Bug issue modeller 10.0
by Henry Monteiro 07 Feb '21

07 Feb '21

Greetings, I got the keys recently but I stumbled on a problem trying to run the program. When I type and run the command "mod10.0 foo.py" (ubuntu 20.04) this come in response: "Could not find platform independent libraries <prefix> Could not find platform dependent libraries <exec_prefix> Consider setting $PYTHONHOME to <prefix>[:<exec_prefix>] 'import site' failed; use -v for traceback FATAL ERROR: Cannot open file foo.py: No such file or directory" Could you guys have any clue how to repair this problem? Sincerely, Henry Magalhães

2 1

Modeller 10.0 release
by Modeller Caretaker 02 Feb '21

02 Feb '21

A new version of Modeller, 10.0, is now available for download! Please see the download page at https://salilab.org/modeller/ for more information. If you have a license key for Modeller 8 or 9, there is no need to reregister for Modeller 10.0 - the same license key will work. (It won't do any harm to reregister if you want to, though!) 10.0 is a major update that adds support for residue numbers >= 10000 in PDB format files using hybrid-36 notation, assigns the chain ID 'A' to single-chain models to generate more standard PDB files, and uses CamelCase naming for all Python classes. See the Modeller manual for a full change log: https://salilab.org/modeller/10.0/manual/node40.html If you encounter bugs in Modeller 10.0, please see https://salilab.org/modeller/10.0/manual/node10.html for information on how to report them. Note: you are receiving this email either because you subscribed to the modeller_usage mailing list, or you provided this address when you requested a Modeller license and you ticked the "notify me of new releases" box. In the latter case, if you no longer wish to receive announcements of new Modeller releases, simply unsubscribe from the modeller_announce mailing list, or reply to this email and let us know. Ben Webb, Modeller Caretaker -- modeller-care(a)salilab.org https://salilab.org/modeller/ Modeller mail list: https://salilab.org/mailman/listinfo/modeller_usage

1 0

← Newer
1
...
5
6
7
8
9
10
11
...
315
Older →

Jump to page:

2024

2023

2022

2021

2020

2019

2018

2017

2016

2015

2014

2013

2012

2011

2010

2009

2008

2007

2006

2005

2004

2003

2002

2001

2000

1999

1998

1997

modeller_usage